Lineage for d1a1za_ (1a1z A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. Superfamily a.77.1: DEATH domain [47986] (5 families) (S)
  5. Family a.77.1.4: DEATH effector domain, DED [81388] (2 proteins)
  6. Protein FADD (Mort1) [81387] (1 species)
    contains two domains of this superfamily: DED and DD, in this order
  7. Species Human (Homo sapiens) [TaxId:9606] [81386] (3 PDB entries)
  8. Domain d1a1za_: 1a1z A: [18427]
    mutant

Details for d1a1za_

PDB Entry: 1a1z (more details)

PDB Description: fadd death effector domain, f25g mutant, nmr minimized average structure
PDB Compounds: (A:) fadd protein

SCOPe Domain Sequences for d1a1za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a1za_ a.77.1.4 (A:) FADD (Mort1) {Human (Homo sapiens) [TaxId: 9606]}
mdpflvllhsvssslssseltelkglclgrvgkrklervqsgldlfsmlleqndlepght
ellrellaslrrhdllrrvddfe

SCOPe Domain Coordinates for d1a1za_ are not available.

Timeline for d1a1za_: