Lineage for d3q7zb_ (3q7z B:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618349Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2618350Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2618351Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2619196Protein automated matches [190161] (30 species)
    not a true protein
  7. 2619561Species Staphylococcus aureus [TaxId:1280] [189852] (11 PDB entries)
  8. 2619575Domain d3q7zb_: 3q7z B: [184269]
    automated match to d1xa1c_
    complexed with bou

Details for d3q7zb_

PDB Entry: 3q7z (more details), 1.87 Å

PDB Description: cbap-acylated blar1 sensor domain from staphylococcus aureus
PDB Compounds: (B:) Beta-lactamase regulatory protein BlaR1

SCOPe Domain Sequences for d3q7zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q7zb_ e.3.1.1 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
qsitdynykkplhndyqildkskifgsnsgsfvmysmaadayyiynekesrkryspnsty
kiylamfgldrhiindensrmswnhkhypfdawnkeqdlntamqnsvnwyferisdqipk
nytatqlkqlnygnknlgsyksywmedslkisnleqvivfknmmeqnnhfskkaknqlss
sllikknekyelygktgtgivngkynngwfvgyvitnhdkyyfathlsdgkpsgknaeli
sekilkemgvln

SCOPe Domain Coordinates for d3q7zb_:

Click to download the PDB-style file with coordinates for d3q7zb_.
(The format of our PDB-style files is described here.)

Timeline for d3q7zb_: