![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
![]() | Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) ![]() |
![]() | Family c.68.1.0: automated matches [191551] (1 protein) not a true family |
![]() | Protein automated matches [190951] (34 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [189483] (7 PDB entries) |
![]() | Domain d3q7ub_: 3q7u B: [184265] automated match to d1vpaa_ complexed with ctp, mg |
PDB Entry: 3q7u (more details), 2.1 Å
SCOPe Domain Sequences for d3q7ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q7ub_ c.68.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} gevvaivpaagsgerlavgvpkafyqldgqtlieravdglldsgvvdtvvvavpadrtde arqilghramivaggsnrtdtvnlaltvlsgtaepefvlvhdaaraltppalvarvveal rdgyaavvpvlplsdtikavdangvvlgtperaglravqtpqgfttdlllrsyqrgsldl paaeytddaslvehiggqvqvvdgdplafkittkldlllaqaivrg
Timeline for d3q7ub_: