Lineage for d3q7ub_ (3q7u B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2899284Family c.68.1.0: automated matches [191551] (1 protein)
    not a true family
  6. 2899285Protein automated matches [190951] (34 species)
    not a true protein
  7. 2899384Species Mycobacterium tuberculosis [TaxId:83332] [189483] (7 PDB entries)
  8. 2899389Domain d3q7ub_: 3q7u B: [184265]
    automated match to d1vpaa_
    complexed with ctp, mg

Details for d3q7ub_

PDB Entry: 3q7u (more details), 2.1 Å

PDB Description: Structure of Mtb 2-C-methyl-D-erythritol 4-phosphate cytidyltransferase (IspD) complexed with CTP
PDB Compounds: (B:) 2-C-methyl-D-erythritol 4-phosphate cytidyltransferase

SCOPe Domain Sequences for d3q7ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q7ub_ c.68.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
gevvaivpaagsgerlavgvpkafyqldgqtlieravdglldsgvvdtvvvavpadrtde
arqilghramivaggsnrtdtvnlaltvlsgtaepefvlvhdaaraltppalvarvveal
rdgyaavvpvlplsdtikavdangvvlgtperaglravqtpqgfttdlllrsyqrgsldl
paaeytddaslvehiggqvqvvdgdplafkittkldlllaqaivrg

SCOPe Domain Coordinates for d3q7ub_:

Click to download the PDB-style file with coordinates for d3q7ub_.
(The format of our PDB-style files is described here.)

Timeline for d3q7ub_: