Lineage for d1e3ya_ (1e3y A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004166Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 2004167Superfamily a.77.1: DEATH domain [47986] (5 families) (S)
  5. 2004168Family a.77.1.2: DEATH domain, DD [81312] (9 proteins)
    Pfam PF00531
  6. 2004169Protein FADD (Mort1) [47992] (2 species)
    contains two domains of this superfamily: DED and DD, in this order
  7. 2004170Species Human (Homo sapiens) [TaxId:9606] [47993] (4 PDB entries)
  8. 2004180Domain d1e3ya_: 1e3y A: [18426]

Details for d1e3ya_

PDB Entry: 1e3y (more details)

PDB Description: death domain from human fadd/mort1
PDB Compounds: (A:) fadd protein

SCOPe Domain Sequences for d1e3ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e3ya_ a.77.1.2 (A:) FADD (Mort1) {Human (Homo sapiens) [TaxId: 9606]}
gshmgeedlcaafnvicdnvgkdwrrlarqlkvsdtkidsiedryprnltervreslriw
kntekenatvahlvgalrscqmnlvadlvqevqqardlqnrsga

SCOPe Domain Coordinates for d1e3ya_:

Click to download the PDB-style file with coordinates for d1e3ya_.
(The format of our PDB-style files is described here.)

Timeline for d1e3ya_: