Class a: All alpha proteins [46456] (284 folds) |
Fold a.77: DEATH domain [47985] (1 superfamily) 6 helices: closed bundle; greek-key; internal pseudo twofold symmetry |
Superfamily a.77.1: DEATH domain [47986] (4 families) |
Family a.77.1.2: DEATH domain, DD [81312] (9 proteins) Pfam PF00531 |
Protein FADD (Mort1) [47992] (2 species) contains two domains of this superfamily: DED and DD, in this order |
Species Human (Homo sapiens) [TaxId:9606] [47993] (3 PDB entries) |
Domain d1e3ya_: 1e3y A: [18426] |
PDB Entry: 1e3y (more details)
SCOPe Domain Sequences for d1e3ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e3ya_ a.77.1.2 (A:) FADD (Mort1) {Human (Homo sapiens) [TaxId: 9606]} gshmgeedlcaafnvicdnvgkdwrrlarqlkvsdtkidsiedryprnltervreslriw kntekenatvahlvgalrscqmnlvadlvqevqqardlqnrsga
Timeline for d1e3ya_: