Lineage for d1e3ya_ (1e3y A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.77: DEATH domain [47985] (1 superfamily) Superfamily a.77.1: DEATH domain [47986] (1 family) 
Family a.77.1.1: DEATH domain [47987] (9 proteins) 
Protein FADD (Mort1) [47992] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [47993] (4 PDB entries) 
Domain d1e3ya_: 1e3y A: [18426]
Details for d1e3ya_
PDB Entry: 1e3y (more details)
PDB Description: death domain from human fadd/mort1
SCOP Domain Sequences for d1e3ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e3ya_ a.77.1.1 (A:) FADD (Mort1) {Human (Homo sapiens)}
gshmgeedlcaafnvicdnvgkdwrrlarqlkvsdtkidsiedryprnltervreslriw
kntekenatvahlvgalrscqmnlvadlvqevqqardlqnrsga
SCOP Domain Coordinates for d1e3ya_:
Click to download the PDB-style file with coordinates for d1e3ya_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e3ya_:
- d1e3ya_ appears in SCOP 1.57
- d1e3ya_ appears in the current release, SCOPe 2.08, called d1e3ya1
View in 3D