Lineage for d1e3ya1 (1e3y A:93-192)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718930Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 2718931Superfamily a.77.1: DEATH domain [47986] (5 families) (S)
  5. 2718932Family a.77.1.2: DEATH domain, DD [81312] (9 proteins)
    Pfam PF00531
  6. 2718933Protein FADD (Mort1) [47992] (2 species)
    contains two domains of this superfamily: DED and DD, in this order
  7. 2718934Species Human (Homo sapiens) [TaxId:9606] [47993] (4 PDB entries)
  8. 2718944Domain d1e3ya1: 1e3y A:93-192 [18426]
    Other proteins in same PDB: d1e3ya2

Details for d1e3ya1

PDB Entry: 1e3y (more details)

PDB Description: death domain from human fadd/mort1
PDB Compounds: (A:) fadd protein

SCOPe Domain Sequences for d1e3ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e3ya1 a.77.1.2 (A:93-192) FADD (Mort1) {Human (Homo sapiens) [TaxId: 9606]}
geedlcaafnvicdnvgkdwrrlarqlkvsdtkidsiedryprnltervreslriwknte
kenatvahlvgalrscqmnlvadlvqevqqardlqnrsga

SCOPe Domain Coordinates for d1e3ya1:

Click to download the PDB-style file with coordinates for d1e3ya1.
(The format of our PDB-style files is described here.)

Timeline for d1e3ya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e3ya2