SCOPe 2.05: Domain d1a1wa_: 1a1w A:

Lineage for d1a1wa_ (1a1w A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.77: DEATH domain [47985] (1 superfamily)
   6 helices: closed bundle; greek-key; internal pseudo twofold symmetry

4. Superfamily a.77.1: DEATH domain [47986] (5 families)

5. Family a.77.1.4: DEATH effector domain, DED [81388] (2 proteins)

6. Protein FADD (Mort1) [81387] (1 species)
   contains two domains of this superfamily: DED and DD, in this order

7. Species Human (Homo sapiens) [TaxId:9606] [81386] (3 PDB entries)

8. Domain d1a1wa_: 1a1w A: [18425]
   mutant

Details for d1a1wa_

PDB Entry: 1a1w

PDB Description: fadd death effector domain, f25y mutant, nmr minimized average structure

PDB Compounds: (A:) fadd protein

SCOPe Domain Sequences for d1a1wa_:

Sequence; same for both SEQRES and ATOM records:

>d1a1wa_ a.77.1.4 (A:) FADD (Mort1) {Human (Homo sapiens) [TaxId: 9606]}
mdpflvllhsvssslssseltelkylclgrvgkrklervqsgldlfsmlleqndlepght
ellrellaslrrhdllrrvddfe

Timeline for d1a1wa_:

• d1a1wa_ first appeared (with stable ids) in SCOP 1.55, called d1a1w__
  
• d1a1wa_ appears in SCOPe 2.04
  
• d1a1wa_ appears in SCOPe 2.06
  
• d1a1wa_ appears in the current release, SCOPe 2.08