Lineage for d3q7hb_ (3q7h B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 980706Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 980707Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 980708Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
  6. 980845Protein automated matches [190149] (5 species)
    not a true protein
  7. 980882Species Coxiella burnetii [TaxId:360115] [189606] (1 PDB entry)
  8. 980884Domain d3q7hb_: 3q7h B: [184245]
    automated match to d1tyfa_
    complexed with ca, peg

Details for d3q7hb_

PDB Entry: 3q7h (more details), 2.5 Å

PDB Description: Structure of the ClpP subunit of the ATP-dependent Clp Protease from Coxiella burnetii
PDB Compounds: (B:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d3q7hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q7hb_ c.14.1.1 (B:) automated matches {Coxiella burnetii [TaxId: 360115]}
vlvpmvveqtsrgeraydiysrllkdrviflvgqvedhmanlaiaqmlflesenpnkdin
lyinspggavtsamaiydtmqfvkpdvrtlcigqaasagalllaggakgkrhclphssvm
ihqvlggyqgqgtdiqihakqtqrvsdqlnqilakhtgkdiervekdtnrdyfltpeeav
eyglidsifkerp

SCOPe Domain Coordinates for d3q7hb_:

Click to download the PDB-style file with coordinates for d3q7hb_.
(The format of our PDB-style files is described here.)

Timeline for d3q7hb_: