Lineage for d3q7ha_ (3q7h A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1835239Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1835240Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1835241Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 1835406Protein automated matches [190149] (9 species)
    not a true protein
  7. 1835450Species Coxiella burnetii [TaxId:360115] [189606] (1 PDB entry)
  8. 1835451Domain d3q7ha_: 3q7h A: [184244]
    automated match to d1tyfa_
    complexed with ca, peg

Details for d3q7ha_

PDB Entry: 3q7h (more details), 2.5 Å

PDB Description: Structure of the ClpP subunit of the ATP-dependent Clp Protease from Coxiella burnetii
PDB Compounds: (A:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d3q7ha_:

Sequence, based on SEQRES records: (download)

>d3q7ha_ c.14.1.1 (A:) automated matches {Coxiella burnetii [TaxId: 360115]}
lvpmvveqtsrgeraydiysrllkdrviflvgqvedhmanlaiaqmlflesenpnkdinl
yinspggavtsamaiydtmqfvkpdvrtlcigqaasagalllaggakgkrhclphssvmi
hqvlggyqgqgtdiqihakqtqrvsdqlnqilakhtgkdiervekdtnrdyfltpeeave
yglidsifkerp

Sequence, based on observed residues (ATOM records): (download)

>d3q7ha_ c.14.1.1 (A:) automated matches {Coxiella burnetii [TaxId: 360115]}
lvpmvveqaydiysrllkdrviflvgqvedhmanlaiaqmlflesenpnkdinlyinspg
gavtsamaiydtmqfvkpdvrtlcigqaasagalllaggakgkrhclphssvmihqvlgg
yqgqgtdiqihakqtqrvsdqlnqilakhtgkdiervekdtnrdyfltpeeaveyglids
ifkerp

SCOPe Domain Coordinates for d3q7ha_:

Click to download the PDB-style file with coordinates for d3q7ha_.
(The format of our PDB-style files is described here.)

Timeline for d3q7ha_: