SCOPe 2.08: Domain d3q6sc_: 3q6s C:

Lineage for d3q6sc_ (3q6s C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.2: Chromo domain [54165] (8 proteins)
   lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold

6. Protein Heterochromatin protein 1, HP1 [54166] (4 species)
   duplication: consists of two homologous domains, N-terminal chromo domain and C-terminal chromo shadow domain

7. Species Human (Homo sapiens) [TaxId:9606] [187099] (3 PDB entries)

8. Domain d3q6sc_: 3q6s C: [184233]
   automated match to d1s4za_

Details for d3q6sc_

PDB Entry: 3q6s, 1.93 Å

PDB Description: The crystal structure of the heterochromatin protein 1 beta chromoshadow domain complexed with a peptide from Shugoshin 1

PDB Compounds: (C:) chromobox protein homolog 1

SCOPe Domain Sequences for d3q6sc_:

Sequence; same for both SEQRES and ATOM records:

>d3q6sc_ b.34.13.2 (C:) Heterochromatin protein 1, HP1 {Human (Homo sapiens) [TaxId: 9606]}
prgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvisfyeerlt
whsy

Timeline for d3q6sc_:

• d3q6sc_ first appeared in SCOPe 2.01
  
• d3q6sc_ appears in SCOPe 2.07