Lineage for d3q6sa_ (3q6s A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 947418Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 947452Family b.34.13.2: Chromo domain [54165] (8 proteins)
    lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold
  6. 947497Protein Heterochromatin protein 1, HP1 [54166] (4 species)
    duplication: consists of two homologous domains, N-terminal chromo domain and C-terminal chromo shadow domain
  7. 947510Species Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId:10090] [54167] (5 PDB entries)
  8. 947511Domain d3q6sa_: 3q6s A: [184231]
    automated match to d1s4za_

Details for d3q6sa_

PDB Entry: 3q6s (more details), 1.93 Å

PDB Description: The crystal structure of the heterochromatin protein 1 beta chromoshadow domain complexed with a peptide from Shugoshin 1
PDB Compounds: (A:) chromobox protein homolog 1

SCOPe Domain Sequences for d3q6sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q6sa_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]}
kprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvisfyeerl
twhsyp

SCOPe Domain Coordinates for d3q6sa_:

Click to download the PDB-style file with coordinates for d3q6sa_.
(The format of our PDB-style files is described here.)

Timeline for d3q6sa_: