Lineage for d1ddfa1 (1ddf A:201-319)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332045Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 2332046Superfamily a.77.1: DEATH domain [47986] (5 families) (S)
  5. 2332047Family a.77.1.2: DEATH domain, DD [81312] (9 proteins)
    Pfam PF00531
  6. 2332063Protein Fas [47990] (1 species)
  7. 2332064Species Human (Homo sapiens) [TaxId:9606] [47991] (1 PDB entry)
  8. 2332065Domain d1ddfa1: 1ddf A:201-319 [18423]
    Other proteins in same PDB: d1ddfa2

Details for d1ddfa1

PDB Entry: 1ddf (more details)

PDB Description: fas death domain, nmr, minimized average structure
PDB Compounds: (A:) fas

SCOPe Domain Sequences for d1ddfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ddfa1 a.77.1.2 (A:201-319) Fas {Human (Homo sapiens) [TaxId: 9606]}
metvainlsdvdlskyittiagvmtlsqvkgfvrkngvneakideikndnvqdtaeqkvq
llrnwhqlhgkkeaydtlikdlkkanlctlaekiqtiilkditsdsensnfrneiqslv

SCOPe Domain Coordinates for d1ddfa1:

Click to download the PDB-style file with coordinates for d1ddfa1.
(The format of our PDB-style files is described here.)

Timeline for d1ddfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ddfa2