Lineage for d1ddf__ (1ddf -)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) 
Fold a.77: DEATH domain [47985] (1 superfamily) Superfamily a.77.1: DEATH domain [47986] (1 family) 
Family a.77.1.1: DEATH domain [47987] (9 proteins) 
Protein Fas [47990] (1 species) Species Human (Homo sapiens) [TaxId:9606] [47991] (1 PDB entry) 
Domain d1ddf__: 1ddf - [18423]
Details for d1ddf__
PDB Entry: 1ddf (more details)
PDB Description: fas death domain, nmr, minimized average structure
SCOP Domain Sequences for d1ddf__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ddf__ a.77.1.1 (-) Fas {Human (Homo sapiens)}
metvainlsdvdlskyittiagvmtlsqvkgfvrkngvneakideikndnvqdtaeqkvq
llrnwhqlhgkkeaydtlikdlkkanlctlaekiqtiilkditsdsensnfrneiqslvl
ehhhhhh
SCOP Domain Coordinates for d1ddf__:
Click to download the PDB-style file with coordinates for d1ddf__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ddf__:
- d1ddf__ first appeared (with stable ids) in SCOP 1.55
- d1ddf__ appears in SCOP 1.57
- d1ddf__ appears in SCOP 1.61
- d1ddf__ appears in the current release, SCOPe 2.08, called d1ddfa1
View in 3D