Lineage for d1ddf__ (1ddf -)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 99310Fold a.77: DEATH domain [47985] (1 superfamily)
  4. 99311Superfamily a.77.1: DEATH domain [47986] (1 family) (S)
  5. 99312Family a.77.1.1: DEATH domain [47987] (9 proteins)
  6. 99328Protein Fas [47990] (1 species)
  7. 99329Species Human (Homo sapiens) [TaxId:9606] [47991] (1 PDB entry)
  8. 99330Domain d1ddf__: 1ddf - [18423]

Details for d1ddf__

PDB Entry: 1ddf (more details)

PDB Description: fas death domain, nmr, minimized average structure

SCOP Domain Sequences for d1ddf__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ddf__ a.77.1.1 (-) Fas {Human (Homo sapiens)}
metvainlsdvdlskyittiagvmtlsqvkgfvrkngvneakideikndnvqdtaeqkvq
llrnwhqlhgkkeaydtlikdlkkanlctlaekiqtiilkditsdsensnfrneiqslvl
ehhhhhh

SCOP Domain Coordinates for d1ddf__:

Click to download the PDB-style file with coordinates for d1ddf__.
(The format of our PDB-style files is described here.)

Timeline for d1ddf__: