![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein pak1 [56146] (1 species) OPK group; PAK/STE20 subfamily; serine/threonine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [56147] (19 PDB entries) |
![]() | Domain d3q4zb_: 3q4z B: [184215] Other proteins in same PDB: d3q4za2 automated match to d1f3mc_ complexed with anp, mg |
PDB Entry: 3q4z (more details), 1.89 Å
SCOPe Domain Sequences for d3q4zb_:
Sequence, based on SEQRES records: (download)
>d3q4zb_ d.144.1.7 (B:) pak1 {Human (Homo sapiens) [TaxId: 9606]} deeileklriivsvgdpkkkytrfekigqgasgtvytamdvatgqevairqmnlqqqpkk eliineilvmrenknpnivnyldsylvgdelwvvmeylaggsltdvvtetcmdegqiaav creclqaleflhsnqvihrniksdnillgmdgsvkltdfgfcaqitpeqskrstmvgtpy wmapevvtrkaygpkvdiwslgimaiemiegeppylnenplralyliatngtpelqnpek lsaifrdflnrclemdvekrgsakeliqhqflkiakplssltpliaaakeat
>d3q4zb_ d.144.1.7 (B:) pak1 {Human (Homo sapiens) [TaxId: 9606]} deeileklriivsvgdpkkkytrfekigqgasgtvytamdvatgqevairqmnpkkelii neilvmrenknpnivnyldsylvgdelwvvmeylaggsltdvvtetcmdegqiaavcrec lqaleflhsnqvihrniksdnillgmdgsvkltdfqskrstmvgtpywmapevvtrkayg pkvdiwslgimaiemiegeppylnenplralyliatngtpelqnpeklsaifrdflnrcl emdvekrgsakeliqhqflkiakplssltpliaaakeat
Timeline for d3q4zb_: