Lineage for d3q4ya_ (3q4y A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345955Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2345956Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2345961Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2346077Protein Snake phospholipase A2 [48624] (38 species)
  7. 2346093Species Andaman cobra (Naja sagittifera), isoform 4 [TaxId:195058] [89171] (14 PDB entries)
    Uniprot P60045 8-126 # ! yet another isoform, 98% identity
  8. 2346102Domain d3q4ya_: 3q4y A: [184213]
    automated match to d1ln8a_
    complexed with ca, eoh

Details for d3q4ya_

PDB Entry: 3q4y (more details), 2.3 Å

PDB Description: crystal structure of group i phospholipase a2 at 2.3 a resolution in 40% ethanol revealed the critical elements of hydrophobicity of the substrate-binding site
PDB Compounds: (A:) Phospholipase A2 isoform 3

SCOPe Domain Sequences for d3q4ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q4ya_ a.133.1.2 (A:) Snake phospholipase A2 {Andaman cobra (Naja sagittifera), isoform 4 [TaxId: 195058]}
nlyqfknmiqctvpsrswadfadygcycgkggsgtpvddldrccqthdncyneaenisgc
rpyfktysyectqgtltckgdnnacaasvcdcdrlaaicfagapyndanynidlkarcn

SCOPe Domain Coordinates for d3q4ya_:

Click to download the PDB-style file with coordinates for d3q4ya_.
(The format of our PDB-style files is described here.)

Timeline for d3q4ya_: