Lineage for d3q4sa1 (3q4s A:1-262)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133793Family c.68.1.14: Glycogenin [75273] (2 protein domains)
  6. 2133794Protein Glycogenin [75274] (2 species)
  7. 2133795Species Human (Homo sapiens) [TaxId:9606] [189634] (12 PDB entries)
  8. 2133810Domain d3q4sa1: 3q4s A:1-262 [184211]
    Other proteins in same PDB: d3q4sa2
    automated match to d1ll0a_
    complexed with cl, edo

Details for d3q4sa1

PDB Entry: 3q4s (more details), 1.98 Å

PDB Description: Crystal Structure of Human Glycogenin-1 (GYG1), apo form
PDB Compounds: (A:) glycogenin-1

SCOPe Domain Sequences for d3q4sa1:

Sequence, based on SEQRES records: (download)

>d3q4sa1 c.68.1.14 (A:1-262) Glycogenin {Human (Homo sapiens) [TaxId: 9606]}
mtdqafvtlttndayakgalvlgsslkqhrttrrlvvlatpqvsdsmrkvletvfdevim
vdvldsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfdreel
saapdpgwpdcfnsgvfvyqpsvetynqllhlaseqgsfdggdqgilntffsswattdir
khlpfiynlssisifsylpafkvfgasakvvhflgrvkpwnytydpktksvkseahdpnm
thpeflilwwnifttnvlpllq

Sequence, based on observed residues (ATOM records): (download)

>d3q4sa1 c.68.1.14 (A:1-262) Glycogenin {Human (Homo sapiens) [TaxId: 9606]}
mtdqafvtlttndayakgalvlgsslkqhrttrrlvvlatpqvsdsmrkvletvfdevim
vdvldsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfdreel
saapdpgwpdcfnsgvfvyqpsvetynqllhlaseqgsfdggdqgilntffsswattdir
khlpfiynlssisylpafkvfgasakvvhflgrvkpwnytydpktksvkspeflilwwni
fttnvlpllq

SCOPe Domain Coordinates for d3q4sa1:

Click to download the PDB-style file with coordinates for d3q4sa1.
(The format of our PDB-style files is described here.)

Timeline for d3q4sa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3q4sa2