SCOP 1.69: Domain d1b1ba2: 1b1b A:65-140

Lineage for d1b1ba2 (1b1b A:65-140)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family)

5. Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (3 proteins)

6. Protein Iron-dependent regulator [47983] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [47984] (2 PDB entries)

8. Domain d1b1ba2: 1b1b A:65-140 [18421]
   Other proteins in same PDB: d1b1ba1

Details for d1b1ba2

PDB Entry: 1b1b, 2.6 Å

PDB Description: iron dependent regulator

SCOP Domain Sequences for d1b1ba2:

Sequence; same for both SEQRES and ATOM records:

>d1b1ba2 a.76.1.1 (A:65-140) Iron-dependent regulator {Mycobacterium tuberculosis}
tekgralaiavmrkhrlaerllvdviglpweevhaeacrwehvmsedverrlvkvlnnpt
tspfgnpipglvelgv

Timeline for d1b1ba2:

• d1b1ba2 first appeared (with stable ids) in SCOP 1.55
  
• d1b1ba2 appears in SCOP 1.67
  
• d1b1ba2 appears in SCOP 1.71
  
• d1b1ba2 appears in the current release, SCOPe 2.08