Lineage for d3q4gb1 (3q4g B:1-276)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2861263Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2861542Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 2861543Protein automated matches [190116] (28 species)
    not a true protein
  7. 2861671Species Vibrio cholerae [TaxId:243277] [189621] (1 PDB entry)
  8. 2861673Domain d3q4gb1: 3q4g B:1-276 [184209]
    Other proteins in same PDB: d3q4ga2, d3q4gb2
    automated match to d1ee1a_
    complexed with ca

Details for d3q4gb1

PDB Entry: 3q4g (more details), 2.4 Å

PDB Description: Structure of NAD synthetase from Vibrio cholerae
PDB Compounds: (B:) nh(3)-dependent nad(+) synthetase

SCOPe Domain Sequences for d3q4gb1:

Sequence, based on SEQRES records: (download)

>d3q4gb1 c.26.2.0 (B:1-276) automated matches {Vibrio cholerae [TaxId: 243277]}
mehkireemrvlpsidpqfeierrvafikrkltearykslvlgisggvdsttcgrlaqla
veelnqqhntteyqfiavrlpygeqkdedeaqlalsfirpthsvsvnikagvdglhaash
halantglipsdpakvdfikgnvkararmvaqyeiagyvgglvlgtdhsaenitgfytkf
gdgacdlaplfglnkrqvrllaktlgapeqlvyktptadleelapqkadeaalnltyeqi
ddflegkavpaevsqrlvaiyhatqhkrqpiptiyd

Sequence, based on observed residues (ATOM records): (download)

>d3q4gb1 c.26.2.0 (B:1-276) automated matches {Vibrio cholerae [TaxId: 243277]}
mehkireemrvlpsidpqfeierrvafikrkltearykslvlgisggvdsttcgrlaqla
veelnqqhntteyqfiavrlpygeqkdedeaqlalsfirpthsvsvnikagvdglhaash
halantglipskvdfikgnvkararmvaqyeiagyvgglvlgtdhsaenitgfytkfgdg
acdlaplfglnkrqvrllaktlgapeqlvyknltyeqiddflegkavpaevsqrlvaiyh
atqhkrqpiptiyd

SCOPe Domain Coordinates for d3q4gb1:

Click to download the PDB-style file with coordinates for d3q4gb1.
(The format of our PDB-style files is described here.)

Timeline for d3q4gb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3q4gb2