SCOPe 2.06: Domain d3q4ga1: 3q4g A:1-276

Lineage for d3q4ga1 (3q4g A:1-276)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.0: automated matches [191320] (1 protein)
   not a true family

6. Protein automated matches [190116] (24 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:243277] [189621] (1 PDB entry)

8. Domain d3q4ga1: 3q4g A:1-276 [184208]
   Other proteins in same PDB: d3q4ga2, d3q4gb2
   automated match to d1ee1a_
   complexed with ca

Details for d3q4ga1

PDB Entry: 3q4g, 2.4 Å

PDB Description: Structure of NAD synthetase from Vibrio cholerae

PDB Compounds: (A:) nh(3)-dependent nad(+) synthetase

SCOPe Domain Sequences for d3q4ga1:

Sequence, based on SEQRES records:

>d3q4ga1 c.26.2.0 (A:1-276) automated matches {Vibrio cholerae [TaxId: 243277]}
mehkireemrvlpsidpqfeierrvafikrkltearykslvlgisggvdsttcgrlaqla
veelnqqhntteyqfiavrlpygeqkdedeaqlalsfirpthsvsvnikagvdglhaash
halantglipsdpakvdfikgnvkararmvaqyeiagyvgglvlgtdhsaenitgfytkf
gdgacdlaplfglnkrqvrllaktlgapeqlvyktptadleelapqkadeaalnltyeqi
ddflegkavpaevsqrlvaiyhatqhkrqpiptiyd

Sequence, based on observed residues (ATOM records):

>d3q4ga1 c.26.2.0 (A:1-276) automated matches {Vibrio cholerae [TaxId: 243277]}
mehkireemrvlpsidpqfeierrvafikrkltearykslvlgisggvdsttcgrlaqla
veelnqqhntteyqfiavrlpygeqkdedeaqlalsfirpthsvsvnikagvdglhaash
halantglipsdpakvdfikgnvkararmvaqyeiagyvgglvlgtdhsaenitgfytkf
gdgacdlaplfglnkrqvrllaktlgapeqlvyktptadlnltyeqiddflegkavpaev
sqrlvaiyhatqhkrqpiptiyd

Timeline for d3q4ga1:

• d3q4ga1 first appeared in SCOPe 2.01, called d3q4ga_
  
• d3q4ga1 was called d3q4ga_ in SCOPe 2.05
  
• d3q4ga1 appears in SCOPe 2.07
  
• d3q4ga1 appears in the current release, SCOPe 2.08