Lineage for d3q46a_ (3q46 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2384029Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2384030Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins)
    barrel, closed; n=5, S=8
  6. 2384138Protein automated matches [191079] (3 species)
    not a true protein
  7. 2384151Species Thermococcus thioreducens [TaxId:277988] [189009] (8 PDB entries)
  8. 2384152Domain d3q46a_: 3q46 A: [184205]
    automated match to d1twla_
    complexed with cl, epe, mg, po4

Details for d3q46a_

PDB Entry: 3q46 (more details), 0.99 Å

PDB Description: Magnesium activated Inorganic pyrophosphatase from Thermococcus thioreducens bound to hydrolyzed product at 0.99 Angstrom resolution
PDB Compounds: (A:) Tt-IPPase

SCOPe Domain Sequences for d3q46a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q46a_ b.40.5.1 (A:) automated matches {Thermococcus thioreducens [TaxId: 277988]}
mnpfhelepgpevpevvyalieipkgsrnkyeldkatgllkldrvlyspffypvdygiip
qtwyddgdpfdimvimrepvypltiiearpigimkmedsgdkdwkvlavpvedpyfndwk
disdvpkafldeiahffqrykelqgkttkiegwgnaeeakreilraiemykekfgkee

SCOPe Domain Coordinates for d3q46a_:

Click to download the PDB-style file with coordinates for d3q46a_.
(The format of our PDB-style files is described here.)

Timeline for d3q46a_: