Lineage for d3q3ua1 (3q3u A:1-337)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2720706Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 2720707Protein automated matches [191104] (14 species)
    not a true protein
  7. 2720878Species Trametes cervina [TaxId:295351] [189654] (1 PDB entry)
  8. 2720879Domain d3q3ua1: 3q3u A:1-337 [184198]
    Other proteins in same PDB: d3q3ua2
    automated match to d1b85b_
    complexed with ca, cl, hem, mpd, na

Details for d3q3ua1

PDB Entry: 3q3u (more details), 1.85 Å

PDB Description: Trametes cervina lignin peroxidase
PDB Compounds: (A:) Lignin peroxidase

SCOPe Domain Sequences for d3q3ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q3ua1 a.93.1.0 (A:1-337) automated matches {Trametes cervina [TaxId: 295351]}
vscgggrsvknaaccawfpvlddiqanlfnggkceeeaheavrltfhdavgfslaaqkag
kfggggadgsilafsdietafipnfglefttegfipfalahgvsfgdfvqfagavgaanc
aggprlqflagrsnisqpspdglvpdptdsadkilarmadigfsptevvhllashsiaaq
yevdtdvagspfdstpsvfdtqffvesllhgtqftgsgqggevmspipgefrlqsdfals
rdprtacewqalvnnqqamvnnfeavmsrlavigqipselvdcsdviptpplakvaqvgs
lppgksmadvqvactngmpfpslptspgpvqtvapvl

SCOPe Domain Coordinates for d3q3ua1:

Click to download the PDB-style file with coordinates for d3q3ua1.
(The format of our PDB-style files is described here.)

Timeline for d3q3ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3q3ua2