![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily) corner-like structure formed by two sheets and filled in with 2-3 helices |
![]() | Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family) ![]() duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like fold |
![]() | Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (4 proteins) note: the solution structure determinations disagree in the relative orientations of two motifs |
![]() | Protein Toluene-4-monooxygenase catalytic effector protein [64394] (1 species) |
![]() | Species Pseudomonas mendocina [TaxId:300] [64395] (15 PDB entries) |
![]() | Domain d3q3mh_: 3q3m H: [184191] Other proteins in same PDB: d3q3ma_, d3q3mc_, d3q3md_, d3q3mg_ automated match to d1g10a_ complexed with fe, z82 |
PDB Entry: 3q3m (more details), 1.75 Å
SCOPe Domain Sequences for d3q3mh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q3mh_ d.137.1.1 (H:) Toluene-4-monooxygenase catalytic effector protein {Pseudomonas mendocina [TaxId: 300]} stladqalhnnnvgpiiragdlvepvietaeidnpgkeitvedrrayvriaaegeliltr ktleeqlgrpfnmqeleinlasfagqiqadedqirfyfdktm
Timeline for d3q3mh_: