Lineage for d3q3mc_ (3q3m C:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194674Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1196311Superfamily d.15.12: TmoB-like [110814] (2 families) (S)
    possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies
  5. 1196332Family d.15.12.0: automated matches [191572] (1 protein)
    not a true family
  6. 1196333Protein automated matches [190991] (1 species)
    not a true protein
  7. 1196334Species Pseudomonas mendocina [TaxId:300] [188696] (13 PDB entries)
  8. 1196336Domain d3q3mc_: 3q3m C: [184187]
    Other proteins in same PDB: d3q3ma_, d3q3md_, d3q3me_, d3q3mh_
    automated match to d1t0rc_
    complexed with fe, z82

Details for d3q3mc_

PDB Entry: 3q3m (more details), 1.75 Å

PDB Description: toluene 4 monooxygenase hd complex with inhibitor 4-bromobenzoate
PDB Compounds: (C:) Toluene-4-monooxygenase system protein B

SCOPe Domain Sequences for d3q3mc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q3mc_ d.15.12.0 (C:) automated matches {Pseudomonas mendocina [TaxId: 300]}
safpvhaafekdflvqlvvvdlndsmdqvaekvayhcvnrrvapregvmrvrkhrstelf
prdmtiaesglnptevidvvfe

SCOPe Domain Coordinates for d3q3mc_:

Click to download the PDB-style file with coordinates for d3q3mc_.
(The format of our PDB-style files is described here.)

Timeline for d3q3mc_: