![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
![]() | Protein automated matches [190435] (5 species) not a true protein |
![]() | Species Pseudomonas mendocina [TaxId:300] [188695] (14 PDB entries) |
![]() | Domain d3q3ma_: 3q3m A: [184186] Other proteins in same PDB: d3q3mc_, d3q3me_, d3q3mg_, d3q3mh_ automated match to d1t0qa_ complexed with fe, z82 |
PDB Entry: 3q3m (more details), 1.75 Å
SCOPe Domain Sequences for d3q3ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q3ma_ a.25.1.2 (A:) automated matches {Pseudomonas mendocina [TaxId: 300]} amhprkdwyeltratnwtpsyvteeqlfpermsghmgiplekwesydepyktsypeyvsi qrekdagaysvkaalerakiyensdpgwistlkshygaiavgeyaavtgegrmarfskap gnrnmatfgmmdelrhgqlqlffpheyckkdrqfdwawrayhsnewaaiaakhffddiit grdaisvaimltfsfetgftnmqflglaadaaeagdytfanlissiqtdesrhaqqggpa lqlliengkreeaqkkvdmaiwrawrlfavltgpvmdyytpledrsqsfkefmyewiigq ferslidlgldkpwywdlflkdidelhhsyhmgvwywrttawwnpaagvtpeerdwleek ypgwnkrwgrcwdvitenvlndrmdlvspetlpsvcnmsqiplvgvpgddwnievfsleh ngrlyhfgsevdrwvfqqdpvqyqnhmnivdrflagqiqpmtlegalkymgfqsieemgk dahdfawadkc
Timeline for d3q3ma_: