Lineage for d3q32b_ (3q32 B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1932524Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 1932525Protein automated matches [190417] (21 species)
    not a true protein
  7. 1932655Species Human (Homo sapiens) [TaxId:9606] [187294] (615 PDB entries)
  8. 1933117Domain d3q32b_: 3q32 B: [184179]
    automated match to d1u46a_
    complexed with j2i

Details for d3q32b_

PDB Entry: 3q32 (more details), 2.5 Å

PDB Description: Structure of Janus kinase 2 with a pyrrolotriazine inhibitor
PDB Compounds: (B:) Tyrosine-protein kinase JAK2

SCOPe Domain Sequences for d3q32b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q32b_ d.144.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrdptqfeerhlkflqqlgkgnfgsvemcrydplqdntgevvavkklqhsteehlrdfer
eieilkslqhdnivkykgvcysagrrnlklimeylpygslrdylqkhkeridhikllqyt
sqickgmeylgtkryihrdlatrnilvenenrvkigdfgltkvlpqdkeyykvkepgesp
ifwyapeslteskfsvasdvwsfgvvlyelftyieksksppaefmrmigndkqgqmivfh
liellknngrlprpdgcpdeiymimtecwnnnvnqrpsfrdlalrvdqirdnmagh

SCOPe Domain Coordinates for d3q32b_:

Click to download the PDB-style file with coordinates for d3q32b_.
(The format of our PDB-style files is described here.)

Timeline for d3q32b_: