Lineage for d3q32b_ (3q32 B:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPKFamily d.144.1.0: automated matches [191359] (1 protein)
not a true familyProtein automated matches [190417] (21 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187294] (615 PDB entries) 
Domain d3q32b_: 3q32 B: [184179]
automated match to d1u46a_
complexed with j2i
Details for d3q32b_
PDB Entry: 3q32 (more details), 2.5 Å
PDB Description: Structure of Janus kinase 2 with a pyrrolotriazine inhibitor
PDB Compounds: (B:) Tyrosine-protein kinase JAK2SCOPe Domain Sequences for d3q32b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q32b_ d.144.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrdptqfeerhlkflqqlgkgnfgsvemcrydplqdntgevvavkklqhsteehlrdfer
eieilkslqhdnivkykgvcysagrrnlklimeylpygslrdylqkhkeridhikllqyt
sqickgmeylgtkryihrdlatrnilvenenrvkigdfgltkvlpqdkeyykvkepgesp
ifwyapeslteskfsvasdvwsfgvvlyelftyieksksppaefmrmigndkqgqmivfh
liellknngrlprpdgcpdeiymimtecwnnnvnqrpsfrdlalrvdqirdnmagh
SCOPe Domain Coordinates for d3q32b_:
Click to download the PDB-style file with coordinates for d3q32b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3q32b_:
- d3q32b_ first appeared in SCOPe 2.01
- d3q32b_ appears in SCOPe 2.04
- d3q32b_ is called d3q32b1 in SCOPe 2.06
- d3q32b_ appears in the current release, SCOPe 2.08, called d3q32b1
View in 3D
