SCOPe 2.07: Domain d3q2ja_: 3q2j A:

Lineage for d3q2ja_ (3q2j A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.6: APH phosphotransferases [64411] (5 proteins)

6. Protein Type IIIa 3',5"-aminoglycoside phosphotransferase [64412] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [64413] (10 PDB entries)

8. Domain d3q2ja_: 3q2j A: [184170]
   automated match to d1j7la_
   complexed with ca, cki

Details for d3q2ja_

PDB Entry: 3q2j, 2.15 Å

PDB Description: crystal structure of 3',5"-aminoglycoside phosphotransferase type iiia protein kinase inhibitor cki-7 complex

PDB Compounds: (A:) Aminoglycoside 3'-phosphotransferase

SCOPe Domain Sequences for d3q2ja_:

Sequence; same for both SEQRES and ATOM records:

>d3q2ja_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]}
mrispelkkliekyrcvkdtegmspakvyklvgenenlylkmtdsrykgttydverekdm
mlwlegklpvpkvlhferhdgwsnllmseadgvlcseeyedeqspekiielyaecirlfh
sidisdcpytnsldsrlaeldyllnndladvdcenweedtpfkdprelydflktekpeee
lvfshgdlgdsnifvkdgkvsgfidlgrsgradkwydiafcvrsiredigeeqyvelffd
llgikpdwekikyyilldelf

Timeline for d3q2ja_:

• d3q2ja_ first appeared in SCOPe 2.01
  
• d3q2ja_ appears in SCOPe 2.06
  
• d3q2ja_ appears in the current release, SCOPe 2.08