SCOP 1.71: Domain d1c0wa2: 1c0w A:65-140

Lineage for d1c0wa2 (1c0w A:65-140)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family)

5. Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (3 proteins)

6. Protein Diphtheria toxin repressor (DtxR) [47981] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [47982] (16 PDB entries)

8. Domain d1c0wa2: 1c0w A:65-140 [18417]
   Other proteins in same PDB: d1c0wa1, d1c0wa3, d1c0wb1, d1c0wb3, d1c0wc1, d1c0wc3, d1c0wd1, d1c0wd3

Details for d1c0wa2

PDB Entry: 1c0w, 3.2 Å

PDB Description: crystal structure of the cobalt-activated diphtheria toxin repressor-dna complex reveals a metal binding sh-like domain

SCOP Domain Sequences for d1c0wa2:

Sequence; same for both SEQRES and ATOM records:

>d1c0wa2 a.76.1.1 (A:65-140) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
tptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvlkdvs
rspfgnpipgldelgv

Timeline for d1c0wa2:

• d1c0wa2 first appeared (with stable ids) in SCOP 1.55
  
• d1c0wa2 appears in SCOP 1.69
  
• d1c0wa2 appears in SCOP 1.73
  
• d1c0wa2 appears in the current release, SCOPe 2.08