Lineage for d1c0wa2 (1c0w A:65-140)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4941Fold a.76: Iron-dependent represor protein, dimerization domain [47978] (1 superfamily)
  4. 4942Superfamily a.76.1: Iron-dependent represor protein, dimerization domain [47979] (1 family) (S)
  5. 4943Family a.76.1.1: Iron-dependent represor protein, dimerization domain [47980] (2 proteins)
  6. 4944Protein Diphtheria toxin repressor (DtxR) [47981] (1 species)
  7. 4945Species Corynebacterium diphtheriae [TaxId:1717] [47982] (10 PDB entries)
  8. 4964Domain d1c0wa2: 1c0w A:65-140 [18417]
    Other proteins in same PDB: d1c0wa1, d1c0wa3, d1c0wb1, d1c0wb3, d1c0wc1, d1c0wc3, d1c0wd1, d1c0wd3

Details for d1c0wa2

PDB Entry: 1c0w (more details), 3.2 Å

PDB Description: crystal structure of the cobalt-activated diphtheria toxin repressor-dna complex reveals a metal binding sh-like domain

SCOP Domain Sequences for d1c0wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c0wa2 a.76.1.1 (A:65-140) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
tptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvlkdvs
rspfgnpipgldelgv

SCOP Domain Coordinates for d1c0wa2:

Click to download the PDB-style file with coordinates for d1c0wa2.
(The format of our PDB-style files is described here.)

Timeline for d1c0wa2: