Lineage for d3q29c_ (3q29 C:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1008597Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1008598Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1008599Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1009303Protein automated matches [190140] (10 species)
    not a true protein
  7. 1009343Species Escherichia coli [TaxId:562] [189978] (2 PDB entries)
  8. 1009346Domain d3q29c_: 3q29 C: [184166]
    automated match to d1a7la_
    complexed with gol, mal, so4

Details for d3q29c_

PDB Entry: 3q29 (more details), 2.3 Å

PDB Description: cyrstal structure of human alpha-synuclein (1-19) fused to maltose binding protein (mbp)
PDB Compounds: (C:) Maltose-binding periplasmic protein/alpha-synuclein chimeric protein

SCOPe Domain Sequences for d3q29c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q29c_ c.94.1.1 (C:) automated matches {Escherichia coli [TaxId: 562]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
lkdaqtnsssmdvfmkglskakeg

SCOPe Domain Coordinates for d3q29c_:

Click to download the PDB-style file with coordinates for d3q29c_.
(The format of our PDB-style files is described here.)

Timeline for d3q29c_: