SCOPe 2.06: Domain d3q29a_: 3q29 A:

Lineage for d3q29a_ (3q29 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein automated matches [190140] (30 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [189978] (9 PDB entries)

8. Domain d3q29a_: 3q29 A: [184165]
   automated match to d1a7la_
   complexed with gol, mal, so4

Details for d3q29a_

PDB Entry: 3q29, 2.3 Å

PDB Description: cyrstal structure of human alpha-synuclein (1-19) fused to maltose binding protein (mbp)

PDB Compounds: (A:) Maltose-binding periplasmic protein/alpha-synuclein chimeric protein

SCOPe Domain Sequences for d3q29a_:

Sequence; same for both SEQRES and ATOM records:

>d3q29a_ c.94.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
lkdaqtnsssmdvfmkglska

Timeline for d3q29a_:

• d3q29a_ first appeared in SCOPe 2.01
  
• d3q29a_ appears in SCOPe 2.05
  
• d3q29a_ appears in SCOPe 2.07
  
• d3q29a_ appears in the current release, SCOPe 2.08