![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.280: RbcX-like [158614] (1 superfamily) 5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer |
![]() | Superfamily a.280.1: RbcX-like [158615] (2 families) ![]() |
![]() | Family a.280.1.0: automated matches [191655] (1 protein) not a true family |
![]() | Protein automated matches [191222] (3 species) not a true protein |
![]() | Species Thermosynechococcus elongatus [TaxId:197221] [189620] (1 PDB entry) |
![]() | Domain d3q20b_: 3q20 B: [184163] automated match to d2peoa1 complexed with act, hez; mutant |
PDB Entry: 3q20 (more details), 1.71 Å
SCOPe Domain Sequences for d3q20b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q20b_ a.280.1.0 (B:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} dvkhiakqttktlisyltyqavrtvigqlaetdpprslwlhqftsqesiqdgerylealf reqpdlgfriltvrehlaemvadylpemlragiqqanlqqraqqle
Timeline for d3q20b_: