SCOPe 2.08: Domain d3q20b_: 3q20 B:

Lineage for d3q20b_ (3q20 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.280: RbcX-like [158614] (1 superfamily)
   5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer

4. Superfamily a.280.1: RbcX-like [158615] (2 families)

5. Family a.280.1.0: automated matches [191655] (1 protein)
   not a true family

6. Protein automated matches [191222] (3 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [189620] (1 PDB entry)

8. Domain d3q20b_: 3q20 B: [184163]
   automated match to d2peoa1
   complexed with act, hez; mutant

Details for d3q20b_

PDB Entry: 3q20, 1.71 Å

PDB Description: Crystal structure of RbcX C103A mutant from Thermosynechococcus elongatus

PDB Compounds: (B:) RbcX protein

SCOPe Domain Sequences for d3q20b_:

Sequence; same for both SEQRES and ATOM records:

>d3q20b_ a.280.1.0 (B:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
dvkhiakqttktlisyltyqavrtvigqlaetdpprslwlhqftsqesiqdgerylealf
reqpdlgfriltvrehlaemvadylpemlragiqqanlqqraqqle

Timeline for d3q20b_:

• d3q20b_ first appeared in SCOPe 2.01
  
• d3q20b_ appears in SCOPe 2.07