Lineage for d3q20a_ (3q20 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1755097Fold a.280: RbcX-like [158614] (1 superfamily)
    5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer
  4. 1755098Superfamily a.280.1: RbcX-like [158615] (2 families) (S)
  5. 1755160Family a.280.1.0: automated matches [191655] (1 protein)
    not a true family
  6. 1755161Protein automated matches [191222] (3 species)
    not a true protein
  7. 1755174Species Thermosynechococcus elongatus [TaxId:197221] [189620] (1 PDB entry)
  8. 1755175Domain d3q20a_: 3q20 A: [184162]
    automated match to d2peoa1
    complexed with act, hez; mutant

Details for d3q20a_

PDB Entry: 3q20 (more details), 1.71 Å

PDB Description: Crystal structure of RbcX C103A mutant from Thermosynechococcus elongatus
PDB Compounds: (A:) RbcX protein

SCOPe Domain Sequences for d3q20a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q20a_ a.280.1.0 (A:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
mdvkhiakqttktlisyltyqavrtvigqlaetdpprslwlhqftsqesiqdgeryleal
freqpdlgfriltvrehlaemvadylpemlragiqqanlqqraqqlermtqvse

SCOPe Domain Coordinates for d3q20a_:

Click to download the PDB-style file with coordinates for d3q20a_.
(The format of our PDB-style files is described here.)

Timeline for d3q20a_: