Class a: All alpha proteins [46456] (286 folds) |
Fold a.280: RbcX-like [158614] (1 superfamily) 5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer |
Superfamily a.280.1: RbcX-like [158615] (2 families) |
Family a.280.1.0: automated matches [191655] (1 protein) not a true family |
Protein automated matches [191222] (3 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:197221] [189620] (1 PDB entry) |
Domain d3q20a_: 3q20 A: [184162] automated match to d2peoa1 complexed with act, hez; mutant |
PDB Entry: 3q20 (more details), 1.71 Å
SCOPe Domain Sequences for d3q20a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q20a_ a.280.1.0 (A:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} mdvkhiakqttktlisyltyqavrtvigqlaetdpprslwlhqftsqesiqdgeryleal freqpdlgfriltvrehlaemvadylpemlragiqqanlqqraqqlermtqvse
Timeline for d3q20a_: