Lineage for d1ddnd2 (1ddn D:65-120)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 49303Fold a.76: Iron-dependent represor protein, dimerization domain [47978] (1 superfamily)
  4. 49304Superfamily a.76.1: Iron-dependent represor protein, dimerization domain [47979] (1 family) (S)
  5. 49305Family a.76.1.1: Iron-dependent represor protein, dimerization domain [47980] (2 proteins)
  6. 49306Protein Diphtheria toxin repressor (DtxR) [47981] (1 species)
  7. 49307Species Corynebacterium diphtheriae [TaxId:1717] [47982] (11 PDB entries)
  8. 49324Domain d1ddnd2: 1ddn D:65-120 [18416]
    Other proteins in same PDB: d1ddna1, d1ddnb1, d1ddnc1, d1ddnd1

Details for d1ddnd2

PDB Entry: 1ddn (more details), 3 Å

PDB Description: diphtheria tox repressor (c102d mutant)/tox dna operator complex

SCOP Domain Sequences for d1ddnd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ddnd2 a.76.1.1 (D:65-120) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
tptgrtlatavmrkhrlaerlltdiigldinkvhdeadrwehvmsdeverrlvkvl

SCOP Domain Coordinates for d1ddnd2:

Click to download the PDB-style file with coordinates for d1ddnd2.
(The format of our PDB-style files is described here.)

Timeline for d1ddnd2: