SCOPe 2.03: Domain d3q1si_: 3q1s I:

Lineage for d3q1si_ (3q1s I:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interleukin-22 (IL-22) [89036] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89037] (5 PDB entries)

8. Domain d3q1si_: 3q1s I: [184155]
   Other proteins in same PDB: d3q1sl1, d3q1sl2
   automated match to d1m4ra_
   complexed with gol, ipa

Details for d3q1si_

PDB Entry: 3q1s, 2.15 Å

PDB Description: HIV-1 neutralizing antibody Z13e1 in complex with epitope display protein

PDB Compounds: (I:) Interleukin-22

SCOPe Domain Sequences for d3q1si_:

Sequence, based on SEQRES records:

>d3q1si_ a.26.1.3 (I:) Interleukin-22 (IL-22) {Human (Homo sapiens) [TaxId: 9606]}
crldksnfqqpyitnrtfmlakeawnwdditdvrligeklfhgvsmsercylmkqvlnft
leevlfpqsdrfqpymqevvpflarlsnrlstchiegddlhiqrnvqklkdtvkklgesg
eikaigeldllfmslrnaci

Sequence, based on observed residues (ATOM records):

>d3q1si_ a.26.1.3 (I:) Interleukin-22 (IL-22) {Human (Homo sapiens) [TaxId: 9606]}
crldksnmlakeawnwdditdvrligeklfhgvsmsercylmkqvlnftleevpflarls
nrlstchiegddlhiqrnvqklkdtvkklgesgeikaigeldllfmslrnaci

Timeline for d3q1si_:

• d3q1si_ first appeared in SCOPe 2.01
  
• d3q1si_ appears in SCOPe 2.02
  
• d3q1si_ appears in SCOPe 2.04
  
• d3q1si_ appears in the current release, SCOPe 2.08