![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
![]() | Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
![]() | Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins) contains an additional helix in one of the crossover connections |
![]() | Protein Interleukin-22 (IL-22) [89036] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89037] (5 PDB entries) |
![]() | Domain d3q1si_: 3q1s I: [184155] Other proteins in same PDB: d3q1sh_, d3q1sl1, d3q1sl2 automated match to d1m4ra_ complexed with gol, ipa |
PDB Entry: 3q1s (more details), 2.15 Å
SCOPe Domain Sequences for d3q1si_:
Sequence, based on SEQRES records: (download)
>d3q1si_ a.26.1.3 (I:) Interleukin-22 (IL-22) {Human (Homo sapiens) [TaxId: 9606]} crldksnfqqpyitnrtfmlakeawnwdditdvrligeklfhgvsmsercylmkqvlnft leevlfpqsdrfqpymqevvpflarlsnrlstchiegddlhiqrnvqklkdtvkklgesg eikaigeldllfmslrnaci
>d3q1si_ a.26.1.3 (I:) Interleukin-22 (IL-22) {Human (Homo sapiens) [TaxId: 9606]} crldksnmlakeawnwdditdvrligeklfhgvsmsercylmkqvlnftleevpflarls nrlstchiegddlhiqrnvqklkdtvkklgesgeikaigeldllfmslrnaci
Timeline for d3q1si_: