SCOPe 2.06: Domain d3q1ed_: 3q1e D:

Lineage for d3q1ed_ (3q1e D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.0: automated matches [191441] (1 protein)
   not a true family

6. Protein automated matches [190651] (7 species)
   not a true protein

7. Species Zebrafish (Danio rerio) [TaxId:7955] [187781] (5 PDB entries)

8. Domain d3q1ed_: 3q1e D: [184152]
   automated match to d1tfpa_
   complexed with t44; mutant

Details for d3q1ed_

PDB Entry: 3q1e, 1.95 Å

PDB Description: crystal structure of y116t/i16a double mutant of 5-hydroxyisourate hydrolase in complex with t4

PDB Compounds: (D:) 5-hydroxyisourate hydrolase

SCOPe Domain Sequences for d3q1ed_:

Sequence; same for both SEQRES and ATOM records:

>d3q1ed_ b.3.4.0 (D:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
tllsplsthvlnaaqgvpganmtivlhrldpvssawnilttgitnddgrcpglitkenfi
agvykmrfetgkywdalgetcfypyveivftitntsqhyhvplllsrfsysttrgs

Timeline for d3q1ed_:

• d3q1ed_ first appeared in SCOPe 2.01
  
• d3q1ed_ appears in SCOPe 2.05
  
• d3q1ed_ appears in SCOPe 2.07
  
• d3q1ed_ appears in the current release, SCOPe 2.08