Lineage for d3q1ec_ (3q1e C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2378393Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2378753Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 2379529Family b.3.4.0: automated matches [191441] (1 protein)
    not a true family
  6. 2379530Protein automated matches [190651] (8 species)
    not a true protein
  7. 2379586Species Zebrafish (Danio rerio) [TaxId:7955] [187781] (5 PDB entries)
  8. 2379605Domain d3q1ec_: 3q1e C: [184151]
    automated match to d1tfpa_
    complexed with t44; mutant

Details for d3q1ec_

PDB Entry: 3q1e (more details), 1.95 Å

PDB Description: crystal structure of y116t/i16a double mutant of 5-hydroxyisourate hydrolase in complex with t4
PDB Compounds: (C:) 5-hydroxyisourate hydrolase

SCOPe Domain Sequences for d3q1ec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q1ec_ b.3.4.0 (C:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
lsplsthvlnaaqgvpganmtivlhrldpvssawnilttgitnddgrcpglitkenfiag
vykmrfetgkywdalgetcfypyveivftitntsqhyhvplllsrfsysttrgs

SCOPe Domain Coordinates for d3q1ec_:

Click to download the PDB-style file with coordinates for d3q1ec_.
(The format of our PDB-style files is described here.)

Timeline for d3q1ec_: