SCOPe 2.08: Domain d1ddnc2: 1ddn C:65-120

Lineage for d1ddnc2 (1ddn C:65-120)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families)
   automatically mapped to Pfam PF02742

5. Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins)

6. Protein Diphtheria toxin repressor (DtxR) [47981] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [47982] (20 PDB entries)
   Uniprot P33120

8. Domain d1ddnc2: 1ddn C:65-120 [18415]
   Other proteins in same PDB: d1ddna1, d1ddnb1, d1ddnc1, d1ddnd1
   protein/DNA complex; complexed with ni; mutant

Details for d1ddnc2

PDB Entry: 1ddn, 3 Å

PDB Description: diphtheria tox repressor (c102d mutant)/tox dna operator complex

PDB Compounds: (C:) diphtheria tox repressor

SCOPe Domain Sequences for d1ddnc2:

Sequence; same for both SEQRES and ATOM records:

>d1ddnc2 a.76.1.1 (C:65-120) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
tptgrtlatavmrkhrlaerlltdiigldinkvhdeadrwehvmsdeverrlvkvl

Timeline for d1ddnc2:

• d1ddnc2 first appeared (with stable ids) in SCOP 1.55
  
• d1ddnc2 appears in SCOPe 2.07