![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.43: B-box zinc-binding domain [57844] (1 superfamily) zinc-bound alpha+beta motif |
![]() | Superfamily g.43.1: B-box zinc-binding domain [57845] (2 families) ![]() |
![]() | Family g.43.1.1: B-box zinc-binding domain [57846] (8 proteins) |
![]() | Protein automated matches [190972] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188625] (2 PDB entries) |
![]() | Domain d3q1da_: 3q1d A: [184148] automated match to d2d8ua1 complexed with zn |
PDB Entry: 3q1d (more details), 2.15 Å
SCOPe Domain Sequences for d3q1da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q1da_ g.43.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qhlmceeheeekiniyclscevptcslckvfgahkdcevaplptiyk
Timeline for d3q1da_: