Lineage for d3q1da_ (3q1d A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037487Fold g.43: B-box zinc-binding domain [57844] (1 superfamily)
    zinc-bound alpha+beta motif
  4. 3037488Superfamily g.43.1: B-box zinc-binding domain [57845] (2 families) (S)
  5. 3037489Family g.43.1.1: B-box zinc-binding domain [57846] (8 proteins)
  6. 3037512Protein automated matches [190972] (1 species)
    not a true protein
  7. 3037513Species Human (Homo sapiens) [TaxId:9606] [188625] (2 PDB entries)
  8. 3037517Domain d3q1da_: 3q1d A: [184148]
    automated match to d2d8ua1
    complexed with zn

Details for d3q1da_

PDB Entry: 3q1d (more details), 2.15 Å

PDB Description: The B-box domain of Trim54
PDB Compounds: (A:) Tripartite motif-containing protein 54

SCOPe Domain Sequences for d3q1da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q1da_ g.43.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qhlmceeheeekiniyclscevptcslckvfgahkdcevaplptiyk

SCOPe Domain Coordinates for d3q1da_:

Click to download the PDB-style file with coordinates for d3q1da_.
(The format of our PDB-style files is described here.)

Timeline for d3q1da_: