Lineage for d3q15d_ (3q15 D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2101601Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2101602Family c.23.1.1: CheY-related [52173] (26 protein domains)
  6. 2101823Protein Sporulation response regulator Spo0F [52188] (1 species)
  7. 2101824Species Bacillus subtilis [TaxId:1423] [52189] (12 PDB entries)
    Uniprot P06628
  8. 2101826Domain d3q15d_: 3q15 D: [184147]
    automated match to d1fspa_
    complexed with gol, mg, so4

Details for d3q15d_

PDB Entry: 3q15 (more details), 2.19 Å

PDB Description: Crystal Structure of RapH complexed with Spo0F
PDB Compounds: (D:) sporulation initiation phosphotransferase f

SCOPe Domain Sequences for d3q15d_:

Sequence, based on SEQRES records: (download)

>d3q15d_ c.23.1.1 (D:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]}
ekilivddqygirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmdgi
eilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkyl

Sequence, based on observed residues (ATOM records): (download)

>d3q15d_ c.23.1.1 (D:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]}
ekilivddqygirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmdgi
eilkrmkvidenirviimtlthfakpfdideirdavkkyl

SCOPe Domain Coordinates for d3q15d_:

Click to download the PDB-style file with coordinates for d3q15d_.
(The format of our PDB-style files is described here.)

Timeline for d3q15d_: