Lineage for d3q15c_ (3q15 C:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 982187Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 982188Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 982189Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 982393Protein Sporulation response regulator Spo0F [52188] (1 species)
  7. 982394Species Bacillus subtilis [TaxId:1423] [52189] (9 PDB entries)
    Uniprot P06628
  8. 982395Domain d3q15c_: 3q15 C: [184146]
    automated match to d1fspa_
    complexed with gol, mg, so4

Details for d3q15c_

PDB Entry: 3q15 (more details), 2.19 Å

PDB Description: Crystal Structure of RapH complexed with Spo0F
PDB Compounds: (C:) sporulation initiation phosphotransferase f

SCOPe Domain Sequences for d3q15c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q15c_ c.23.1.1 (C:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]}
ekilivddqygirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmdgi
eilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkyl

SCOPe Domain Coordinates for d3q15c_:

Click to download the PDB-style file with coordinates for d3q15c_.
(The format of our PDB-style files is described here.)

Timeline for d3q15c_: