Lineage for d3q14c_ (3q14 C:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1019197Superfamily d.15.12: TmoB-like [110814] (2 families) (S)
    possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies
  5. 1019218Family d.15.12.0: automated matches [191572] (1 protein)
    not a true family
  6. 1019219Protein automated matches [190991] (1 species)
    not a true protein
  7. 1019220Species Pseudomonas mendocina [TaxId:300] [188696] (12 PDB entries)
  8. 1019234Domain d3q14c_: 3q14 C: [184144]
    Other proteins in same PDB: d3q14a_, d3q14e_
    automated match to d1t0rc_
    complexed with fe, pcr

Details for d3q14c_

PDB Entry: 3q14 (more details), 1.75 Å

PDB Description: toluene 4 monooxygenase hd complex with p-cresol
PDB Compounds: (C:) Toluene-4-monooxygenase system protein B

SCOPe Domain Sequences for d3q14c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q14c_ d.15.12.0 (C:) automated matches {Pseudomonas mendocina [TaxId: 300]}
safpvhaafekdflvqlvvvdlndsmdqvaekvayhcvnrrvapregvmrvrkhrstelf
prdmtiaesglnptevidvvfee

SCOPe Domain Coordinates for d3q14c_:

Click to download the PDB-style file with coordinates for d3q14c_.
(The format of our PDB-style files is described here.)

Timeline for d3q14c_: