Lineage for d3q14a_ (3q14 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1990025Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 protein domains)
  6. 1990319Protein automated matches [190435] (11 species)
    not a true protein
  7. 1990411Species Pseudomonas mendocina [TaxId:300] [188695] (20 PDB entries)
  8. 1990415Domain d3q14a_: 3q14 A: [184143]
    Other proteins in same PDB: d3q14c_, d3q14e_
    automated match to d1t0qa_
    complexed with fe, pcr

Details for d3q14a_

PDB Entry: 3q14 (more details), 1.75 Å

PDB Description: toluene 4 monooxygenase hd complex with p-cresol
PDB Compounds: (A:) pentaethylene glycol

SCOPe Domain Sequences for d3q14a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q14a_ a.25.1.2 (A:) automated matches {Pseudomonas mendocina [TaxId: 300]}
amhprkdwyeltratnwtpsyvteeqlfpermsghmgiplekwesydepyktsypeyvsi
qrekdagaysvkaalerakiyensdpgwistlkshygaiavgeyaavtgegrmarfskap
gnrnmatfgmmdelrhgqlqlffpheyckkdrqfdwawrayhsnewaaiaakhffddiit
grdaisvaimltfsfetgftnmqflglaadaaeagdytfanlissiqtdesrhaqqggpa
lqlliengkreeaqkkvdmaiwrawrlfavltgpvmdyytpledrsqsfkefmyewiigq
ferslidlgldkpwywdlflkdidelhhsyhmgvwywrttawwnpaagvtpeerdwleek
ypgwnkrwgrcwdvitenvlndrmdlvspetlpsvcnmsqiplvgvpgddwnievfsleh
ngrlyhfgsevdrwvfqqdpvqyqnhmnivdrflagqiqpmtlegalkymgfqsieemgk
dahdfawadkc

SCOPe Domain Coordinates for d3q14a_:

Click to download the PDB-style file with coordinates for d3q14a_.
(The format of our PDB-style files is described here.)

Timeline for d3q14a_: