SCOP 1.69: Domain d1ddnb2: 1ddn B:65-120

Lineage for d1ddnb2 (1ddn B:65-120)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family)

5. Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (3 proteins)

6. Protein Diphtheria toxin repressor (DtxR) [47981] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [47982] (16 PDB entries)

8. Domain d1ddnb2: 1ddn B:65-120 [18414]
   Other proteins in same PDB: d1ddna1, d1ddnb1, d1ddnc1, d1ddnd1

Details for d1ddnb2

PDB Entry: 1ddn, 3 Å

PDB Description: diphtheria tox repressor (c102d mutant)/tox dna operator complex

SCOP Domain Sequences for d1ddnb2:

Sequence; same for both SEQRES and ATOM records:

>d1ddnb2 a.76.1.1 (B:65-120) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
tptgrtlatavmrkhrlaerlltdiigldinkvhdeadrwehvmsdeverrlvkvl

Timeline for d1ddnb2:

• d1ddnb2 first appeared (with stable ids) in SCOP 1.55
  
• d1ddnb2 appears in SCOP 1.67
  
• d1ddnb2 appears in SCOP 1.71
  
• d1ddnb2 appears in the current release, SCOPe 2.08