Lineage for d3q10c_ (3q10 C:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 984755Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 984756Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 985152Family c.26.1.4: Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63976] (2 protein domains)
    contains C-terminal subdomain similar to one structural repeat of the Creatinase/aminopeptidase family
  6. 985199Protein automated matches [191096] (3 species)
    not a true protein
  7. 985230Species Yersinia pestis [TaxId:632] [189627] (2 PDB entries)
  8. 985237Domain d3q10c_: 3q10 C: [184137]
    automated match to d1ihoa_
    complexed with amp, cl, gol, imd

Details for d3q10c_

PDB Entry: 3q10 (more details), 1.83 Å

PDB Description: pantoate-beta-alanine ligase from yersinia pestis
PDB Compounds: (C:) Pantoate--beta-alanine ligase

SCOPe Domain Sequences for d3q10c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q10c_ c.26.1.4 (C:) automated matches {Yersinia pestis [TaxId: 632]}
namliietlpllrqqirrwrqegkrialvptmgnlheghmtlvdeaktradvvvvtifvn
plqferpddlahyprtlqedcekltrhgadlvfapaaadiypaglekqtyvdvpalstil
egasrpghfrgvstivsklfnliqpdvacfgekdyqqlalirkmvadmgydinivgvptv
rakdglalssrngylteeerqiapqlskimwalaekmalgerqidalleeaaaqllrvgf
tpdelfirdaetlqpltvdsqqavilmaawlgkarlidnqlvdl

SCOPe Domain Coordinates for d3q10c_:

Click to download the PDB-style file with coordinates for d3q10c_.
(The format of our PDB-style files is described here.)

Timeline for d3q10c_: