SCOPe 2.05: Domain d3q10b_: 3q10 B:

Lineage for d3q10b_ (3q10 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.4: Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63976] (2 proteins)
   contains C-terminal subdomain similar to one structural repeat of the Creatinase/aminopeptidase family
   automatically mapped to Pfam PF02569

6. Protein automated matches [191096] (2 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [189627] (2 PDB entries)

8. Domain d3q10b_: 3q10 B: [184136]
   automated match to d1ihoa_
   complexed with amp, cl, gol, imd

Details for d3q10b_

PDB Entry: 3q10, 1.83 Å

PDB Description: pantoate-beta-alanine ligase from yersinia pestis

PDB Compounds: (B:) Pantoate--beta-alanine ligase

SCOPe Domain Sequences for d3q10b_:

Sequence; same for both SEQRES and ATOM records:

>d3q10b_ c.26.1.4 (B:) automated matches {Yersinia pestis [TaxId: 632]}
amliietlpllrqqirrwrqegkrialvptmgnlheghmtlvdeaktradvvvvtifvnp
lqferpddlahyprtlqedcekltrhgadlvfapaaadiypaglekqtyvdvpalstile
gasrpghfrgvstivsklfnliqpdvacfgekdyqqlalirkmvadmgydinivgvptvr
akdglalssrngylteeerqiapqlskimwalaekmalgerqidalleeaaaqllrvgft
pdelfirdaetlqpltvdsqqavilmaawlgkarlidnqlvdlrh

Timeline for d3q10b_:

• d3q10b_ first appeared in SCOPe 2.01
  
• d3q10b_ appears in SCOPe 2.04
  
• d3q10b_ is called d3q10b1 in SCOPe 2.06
  
• d3q10b_ appears in the current release, SCOPe 2.08, called d3q10b1