Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.4: Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63976] (2 proteins) contains C-terminal subdomain similar to one structural repeat of the Creatinase/aminopeptidase family |
Protein automated matches [191096] (3 species) not a true protein |
Species Yersinia pestis [TaxId:632] [189627] (2 PDB entries) |
Domain d3q10b_: 3q10 B: [184136] automated match to d1ihoa_ complexed with amp, cl, gol, imd |
PDB Entry: 3q10 (more details), 1.83 Å
SCOPe Domain Sequences for d3q10b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q10b_ c.26.1.4 (B:) automated matches {Yersinia pestis [TaxId: 632]} amliietlpllrqqirrwrqegkrialvptmgnlheghmtlvdeaktradvvvvtifvnp lqferpddlahyprtlqedcekltrhgadlvfapaaadiypaglekqtyvdvpalstile gasrpghfrgvstivsklfnliqpdvacfgekdyqqlalirkmvadmgydinivgvptvr akdglalssrngylteeerqiapqlskimwalaekmalgerqidalleeaaaqllrvgft pdelfirdaetlqpltvdsqqavilmaawlgkarlidnqlvdlrh
Timeline for d3q10b_: