![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (28 families) ![]() |
![]() | Family a.118.1.8: Pumilio repeat [63611] (2 proteins) this is a repeat family; one repeat unit is 1ib2 A:982-1018 found in domain |
![]() | Protein automated matches [191057] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189670] (4 PDB entries) |
![]() | Domain d3q0sa_: 3q0s A: [184132] automated match to d1m8yb_ protein/RNA complex |
PDB Entry: 3q0s (more details), 2 Å
SCOPe Domain Sequences for d3q0sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q0sa_ a.118.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} grsrlledfrnnrfpnlqlrdlighivefsqdqhgsrfiqqkleratpaerqmvfneilq aayqlmtdvfgnyviqkffefgsldqklalatrirghvlplalqmygcrviqkalesiss dqqvisemvkeldghvlkcvkdqngnhvvqkciecvqpqslqfiidafkgqvfvlsthpy gcrviqrilehctaeqtlpileelhqhteqlvqdqygnyviqhvlehgrpedkskivsei rgkvlalsqhkfasnvvekcvthasraerallidevccqndgphsalytmmkdqyanyvv qkmidmaepaqrkiimhkirphittlrkytygkhilaklekyy
Timeline for d3q0sa_: