Lineage for d3q0qa_ (3q0q A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2725793Family a.118.1.8: Pumilio repeat [63611] (2 proteins)
    this is a repeat family; one repeat unit is 1ib2 A:982-1018 found in domain
  6. 2725819Protein automated matches [191057] (3 species)
    not a true protein
  7. 2725823Species Human (Homo sapiens) [TaxId:9606] [189670] (4 PDB entries)
  8. 2725824Domain d3q0qa_: 3q0q A: [184130]
    automated match to d1m8yb_
    protein/RNA complex

Details for d3q0qa_

PDB Entry: 3q0q (more details), 2 Å

PDB Description: Crystal structure of the PUMILIO-homology domain from Human PUMILIO2 in complex with p38alpha NREa
PDB Compounds: (A:) Pumilio homolog 2

SCOPe Domain Sequences for d3q0qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q0qa_ a.118.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grsrlledfrnnrfpnlqlrdlighivefsqdqhgsrfiqqkleratpaerqmvfneilq
aayqlmtdvfgnyviqkffefgsldqklalatrirghvlplalqmygcrviqkalesiss
dqqvisemvkeldghvlkcvkdqngnhvvqkciecvqpqslqfiidafkgqvfvlsthpy
gcrviqrilehctaeqtlpileelhqhteqlvqdqygnyviqhvlehgrpedkskivsei
rgkvlalsqhkfasnvvekcvthasraerallidevccqndgphsalytmmkdqyanyvv
qkmidmaepaqrkiimhkirphittlrkytygkhilaklekyy

SCOPe Domain Coordinates for d3q0qa_:

Click to download the PDB-style file with coordinates for d3q0qa_.
(The format of our PDB-style files is described here.)

Timeline for d3q0qa_: